FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mG.

https://peptide.genprice.com/web/image/product.template/39757/image_1920?unique=3006b3e

2,249.00 € 2249.0 EUR 2,249.00 €

2,249.00

Not Available For Sale

This combination does not exist.

 






Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.